Protein Info for MMP_RS04775 in Methanococcus maripaludis S2

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR00936: adenosylhomocysteinase" amino acids 3 to 415 (413 residues), 663.1 bits, see alignment E=7.9e-204 PF05221: AdoHcyase" amino acids 3 to 133 (131 residues), 121 bits, see alignment E=1.1e-38 amino acids 137 to 414 (278 residues), 93.4 bits, see alignment E=3e-30 PF00670: AdoHcyase_NAD" amino acids 183 to 343 (161 residues), 177.1 bits, see alignment E=6.3e-56 PF02826: 2-Hacid_dh_C" amino acids 202 to 293 (92 residues), 33.2 bits, see alignment E=6.7e-12 PF07991: KARI_N" amino acids 203 to 267 (65 residues), 23.9 bits, see alignment E=5.4e-09

Best Hits

Swiss-Prot: 100% identical to SIHH_METMP: S-inosyl-L-homocysteine hydrolase (ahcY) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 100% identity to mmp:MMP0920)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYR8 at UniProt or InterPro

Protein Sequence (415 amino acids)

>MMP_RS04775 adenosylhomocysteinase (Methanococcus maripaludis S2)
VSNVKDMSLAPSGHLKMEWAKRHMPVLCRIAEEFKNDKPFEGLTIGMALHLEAKTAILAE
TLLEGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEEYYENLNKVLDSNPDII
IDDGADLIFLIHTERTELIGKIMGGCEETTTGIIRLKSMAEEGALKFPVVNVNDAYTKHL
FDNRYGTGQSAMDGIIRTTNLLIAGKNVVVGGYGWCGRGVASRAAGHGANVIITEVNPIR
ALEAKMDGFTVLKMEEAAKIGDIFVTTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINK
NDLKELSKSVKEARFNIEEYDLGNKKIYLLGEGRLVNLACADGHPCEVMDMSFANQALSA
KFIKENKGKLENEVYEIPYEQDFKIALLKLHSMGADIDELSPEQRKYLSDWKEGT