Protein Info for MMP_RS04760 in Methanococcus maripaludis S2

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR00652: diaminopimelate epimerase" amino acids 1 to 275 (275 residues), 323.7 bits, see alignment E=4.7e-101 PF01678: DAP_epimerase" amino acids 3 to 124 (122 residues), 118.5 bits, see alignment E=1.8e-38 amino acids 155 to 270 (116 residues), 114.7 bits, see alignment E=2.8e-37 PF02567: PhzC-PhzF" amino acids 49 to 272 (224 residues), 29.5 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 100% identical to DAPF_METMP: Diaminopimelate epimerase (dapF) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to mmp:MMP0917)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYS1 at UniProt or InterPro

Protein Sequence (277 amino acids)

>MMP_RS04760 diaminopimelate epimerase (Methanococcus maripaludis S2)
MKFTKMHGLGNDYIYVDAISQKIENPNEISKFVSDRHFGIGSDGLVLILPSDVADFKMRM
FNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVLEMTIENGKVVLVKVDM
GEPILKAEEIPVLSEKHPVIDEEITAKDYCYNFTCVSMGNPHAITYIENVDEFPLEKIGP
LFEIHEKFPRKTNVEFVELIDKNTVKMRVWERGAGETLACGTGACAVLTASVLKGYVGRK
ATVKLLGGDLTIEWNEFDKHIYMTGPATTVFEGEIDI