Protein Info for MMP_RS04735 in Methanococcus maripaludis S2

Annotation: tautomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01361: Tautomerase
  • amino acids 12 to 56 (45 residues), 43.4 bits, E=1.3e-15

Best Hits

KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 100% identity to mmp:MMP0912)

Predicted SEED Role

"4-oxalocrotonate tautomerase (EC 5.3.2.-)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.2.-)

MetaCyc Pathways

• 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
• orthanilate degradation (2/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
• catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (2/6 steps found)
• 2,3-dihydroxybenzoate degradation (1/5 steps found)
• catechol degradation II (meta-cleavage pathway) (1/7 steps found)
• 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
• meta cleavage pathway of aromatic compounds (1/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (1/13 steps found)
• superpathway of aerobic toluene degradation (2/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (3/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.-

Sequence Analysis Tools

See Q6LYS6 at UniProt or InterPro

Protein Sequence (64 amino acids)

>MMP_RS04735 tautomerase family protein (Methanococcus maripaludis S2)
MPVITIEAGLVNKEQKEKLIKEFTKSASEIIGLPEEKFIVFIKENADENVGVGGISLLEL
KSKR