Protein Info for MMP_RS04655 in Methanococcus maripaludis S2

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 162 to 197 (36 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 11 to 290 (280 residues), 95 bits, see alignment E=8.6e-31 PF03023: MurJ" amino acids 87 to 417 (331 residues), 35.8 bits, see alignment E=5.6e-13 PF01554: MatE" amino acids 231 to 383 (153 residues), 36.8 bits, see alignment E=4.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0896)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>MMP_RS04655 flippase (Methanococcus maripaludis S2)
MIKNLKKDGIVKDSAYMIFSNMYSKFAAYLFYFLIPFILGTEGFGVIKGLMPILDTLVII
FCSGIPPAMAKYISGGDFKENTWIYDILKVMFIFSIFGGIFTVFLKYMLGGNYSNLPNVY
FYAVALALPFSVVISWSRGVLQGNLKIKNLSKTWILENTSKVVFLVILSYLFGIVGGILS
ISVSFLIGGIFGIYLLSKSNLEYSFSNILKNIFSPIREKESVKKVIYYSIPIALTTASYR
LVNDLDGIFILSMLGAYDNGVYGYASLLSRLLFLFASAIAIVLIPRISKSKDISYFKKAT
ILNISIVLPALLIIFLFSKELLNLFFGISTPESITSLKILSVSAVFMSTYTICASSLQGL
GYAKIPVYVLFLGILLNAVFNYTLIPNMGIIGGAIATLSSSFVVFVLVWIITFNKLKKIK
YNS