Protein Info for MMP_RS04650 in Methanococcus maripaludis S2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF07720: TPR_3" amino acids 10 to 35 (26 residues), 13.1 bits, see alignment (E = 7.3e-05) PF13432: TPR_16" amino acids 20 to 72 (53 residues), 30.7 bits, see alignment E=2.8e-10 PF13174: TPR_6" amino acids 43 to 72 (30 residues), 12.9 bits, see alignment 0.00013 PF13181: TPR_8" amino acids 45 to 73 (29 residues), 18.2 bits, see alignment 1.8e-06 amino acids 102 to 127 (26 residues), 17.4 bits, see alignment (E = 3.2e-06) amino acids 151 to 180 (30 residues), 28.3 bits, see alignment 1e-09 PF00515: TPR_1" amino acids 46 to 74 (29 residues), 27.8 bits, see alignment 1.3e-09 amino acids 151 to 181 (31 residues), 45.8 bits, see alignment 2.6e-15 PF07719: TPR_2" amino acids 101 to 127 (27 residues), 23.6 bits, see alignment (E = 3.1e-08) amino acids 151 to 180 (30 residues), 36.6 bits, see alignment 2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0895)

Predicted SEED Role

"GTP cyclohydrolase III (methanopterin)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU2 at UniProt or InterPro

Protein Sequence (197 amino acids)

>MMP_RS04650 tetratricopeptide repeat protein (Methanococcus maripaludis S2)
MRNNYGIQKWHSHGALLCNSEKYAEALECYDKILSYYPDDFLAVFGKGMVFLKLKEYEKA
LQCFNSVLNMNPSYIPAIKNKKQVEEKLKKQESENYNKFSKLGVENYKQGNFEKSLSYFE
KAFEINPYSETLRKNIETTRLKLKEILPIRWNNKGVEYYKVKNYQKALECFEKAVKLNPK
FESALKNKTMVQKLIKN