Protein Info for MMP_RS04645 in Methanococcus maripaludis S2

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 7 to 310 (304 residues), 463.8 bits, see alignment E=1.4e-143 PF02540: NAD_synthase" amino acids 9 to 89 (81 residues), 32.8 bits, see alignment E=8.1e-12 PF02568: ThiI" amino acids 23 to 176 (154 residues), 23.8 bits, see alignment E=6.3e-09 PF00958: GMP_synt_C" amino acids 218 to 309 (92 residues), 122.5 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 100% identical to GUAAB_METMP: GMP synthase [glutamine-hydrolyzing] subunit B (guaAB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to mmp:MMP0894)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing], ATP pyrophosphatase subunit (EC 6.3.5.2)" (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU3 at UniProt or InterPro

Protein Sequence (310 amino acids)

>MMP_RS04645 glutamine-hydrolyzing GMP synthase (Methanococcus maripaludis S2)
MFKTEPFIEESIEEIRKQINNRKTIIALSGGVDSAVAAVLTDRAVGDKLLAVYVDTGLMR
KNESEEIWKIFKEQMGLNLKIVEAKDIFLKELEGVIDPEEKRKIIGRLFIEVFEKVAEEQ
GEEVLVQGTIAPDWIESEGQIKTHHNIALPGGMVLDVVEPLRELYKDEVRLLAVALGLPD
QIAHRQPFPGPGLAVRILGEITDEKLAICKEANFIVSEEIEKTELKNELWQYFAAVLDTK
ATGVKGDIRDYNWVVALRFVSSLDAMTAHTPEIPFDLIKKISKRITSEIPNVTRVVLDVT
DKPPATIEFE