Protein Info for MMP_RS04620 in Methanococcus maripaludis S2

Annotation: cobalt transporter CbiM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 70 to 98 (29 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details PF01891: CbiM" amino acids 2 to 201 (200 residues), 190.1 bits, see alignment E=2.3e-60

Best Hits

Swiss-Prot: 40% identical to Y3621_HALWD: Putative metal transport protein HQ_3621A (cbiM) from Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)

KEGG orthology group: K02007, cobalt/nickel transport system permease protein (inferred from 100% identity to mmp:MMP0889)

Predicted SEED Role

"Substrate-specific component NikM of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>MMP_RS04620 cobalt transporter CbiM (Methanococcus maripaludis S2)
MHIPDGFIPLWESGIFWVISLIFLSMSLRWASKEMNEKTVPLFTALAAGIFAIQAMNMPI
PWGTSGHMVGAALTAIVFDSPWAAVLMLALVLIVQGLFFADGGLIVMGTNIFNMGVVGGF
VGYYLFKALKKTNFHAAVFTAGWAATFLASIACAVELAIAGTFPIDLGIQFMGLYHAVIG
IIEGLITAIVVGYLASARPDLVKSVKKVVSNE