Protein Info for MMP_RS04575 in Methanococcus maripaludis S2

Annotation: homoisocitrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00180: Iso_dh" amino acids 6 to 329 (324 residues), 354.6 bits, see alignment E=3.3e-110 TIGR02088: isopropylmalate/isohomocitrate dehydrogenases" amino acids 7 to 330 (324 residues), 442.1 bits, see alignment E=6.2e-137

Best Hits

Swiss-Prot: 42% identical to HICD_PYRHO: Isocitrate--homoisocitrate dehydrogenase (PH1722) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K10978, threo-isocitrate dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to mmp:MMP0880)

Predicted SEED Role

"Coenzyme B synthesis from 2-oxoglutarate: steps 5, 9, and 13" in subsystem Coenzyme B synthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYV7 at UniProt or InterPro

Protein Sequence (339 amino acids)

>MMP_RS04575 homoisocitrate dehydrogenase (Methanococcus maripaludis S2)
MRNTPKICVINGDGIGNEVVPETVRVLNELGDFEFIHAHAGYECFKRCGDAIPENTIEIA
KESDCILFGSVTTPKPTELKNKSYRSPILTLRKELDLYANIRPTYNFDNLDFVIIRENTE
GLYVKKEYYDEKNEVAIAERIISKFGSSRIVKFAFDYAVQNNRKKVSCIHKANVLRVTDG
LFLEVFEEMSKHYEKLGIKSDDYLIDATAMYLIRNPQMFDVLVTTNLFGDILSDEAAGLI
GGLGMSPSANIGDKNGLFEPVHGSAPDIAGKGISNPIATILSAAMMLDHLKMNKEAEYIR
KAVKKTVECKYLTPDLGGNLKTFEVTEKIIESIRSQMIQ