Protein Info for MMP_RS04530 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 305 to 351 (47 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 235 (215 residues), 114.8 bits, see alignment E=7e-37 PF02687: FtsX" amino acids 272 to 390 (119 residues), 71 bits, see alignment E=8.9e-24

Best Hits

Swiss-Prot: 61% identical to Y1507_METJA: Uncharacterized ABC transporter permease MJ1507 (MJ1507) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mmp:MMP0871)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYW4 at UniProt or InterPro

Protein Sequence (397 amino acids)

>MMP_RS04530 ABC transporter permease (Methanococcus maripaludis S2)
MRITDVVSFAGRNITQKKTQSFLTIIGVVIGILAIVSLISLGFGVQNYITSEITTIGANV
ISVLPSQNFGGPAVSKNFNDNDVSAVRNVRGVEEVVAAWFGSYELEYRDQSHYGNVLVIE
PSKFTHVYSKTWGYEPYKGRWIEDSDKYSCMIGYALATNSFDREIDIGDKITINDKKYKV
IGILEETGNPRTENSVILSKDVGEELFEINNEYNMMIVSVRSGEDVNLVSEEIKDELEDS
RGDENFSVLTAEQLAESINSIFEVLTIFLVGVAGISLLVGAVGISNTMHMSILERRKDIG
ILKALGAENTTILSIFVVEAGFLGLFGGIVGTMLGILIAKAIEYIAAISGYGLIRAWISW
ELIVGVLVFSFVVGILSGYFPARSGAKLNPVDTLRGE