Protein Info for MMP_RS04520 in Methanococcus maripaludis S2

Annotation: nucleoside deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00383: dCMP_cyt_deam_1" amino acids 3 to 97 (95 residues), 89.6 bits, see alignment E=1.1e-29 PF14437: MafB19-deam" amino acids 3 to 133 (131 residues), 77.3 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 58% identical to FCA1_CANAX: Cytosine deaminase (FCA1) from Candida albicans

KEGG orthology group: K01485, cytosine deaminase [EC: 3.5.4.1] (inferred from 94% identity to mmz:MmarC7_0117)

MetaCyc: 52% identical to cytosine deaminase (Saccharomyces cerevisiae)
Cytosine deaminase. [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]

Predicted SEED Role

"Cytosine deaminase (EC 3.5.4.1)" (EC 3.5.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYW6 at UniProt or InterPro

Protein Sequence (145 amino acids)

>MMP_RS04520 nucleoside deaminase (Methanococcus maripaludis S2)
VTDFMDEAVKEANLSLKEGGIPIGAVLVYENKIIGRGHNRRVQNNSAILHAEMDALENAG
RLTSDVYKNCELYTTLSPCIMCSGAVLLYKIKKVVIGENKTFLGAEDLLIKNGVAVEVLN
DERCVKMMKEFIENNPKLWNEDIGE