Protein Info for MMP_RS04485 in Methanococcus maripaludis S2

Annotation: putative beta-lysine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR03827: putative beta-lysine N-acetyltransferase" amino acids 10 to 271 (262 residues), 360.2 bits, see alignment E=3.5e-112 PF00583: Acetyltransf_1" amino acids 146 to 229 (84 residues), 37.8 bits, see alignment E=3.1e-13

Best Hits

Swiss-Prot: 100% identical to ABLB_METMP: Beta-lysine N6-acetyltransferase (ablB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0862)

MetaCyc: 100% identical to beta-lysine N6-acetyltransferase (Methanococcus maripaludis)
RXN-18530 [EC: 2.3.1.264]

Predicted SEED Role

"Beta-lysine acetyltransferase (EC 2.3.1.-)" in subsystem Lysine degradation (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.264

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYX3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>MMP_RS04485 putative beta-lysine N-acetyltransferase (Methanococcus maripaludis S2)
MEKIIEINDSIIQISDLNDRIYIMKLGKDVGELIKHVDSVCNEKKLSKVFAKVSGNKKEL
FEKNGYICEGKLENYYSNDDAYFMSKFFEESRKISKFSKEAEDVLNYVKTVGVNPHTKID
EKFHLKIANETDAEKLSKHYSKVFKTYPFPIDDPNYILKTMQTNVKYFIIEDNGKIVAAS
SCEMDIKNKCVEMTDFAVLEEYQKLGLSKYLLYIMEKIMKDNGYRVFYTIARSISYGMNI
TFKKMGYMYSGTAVNNTNICGNFEDMNFWYKLSE