Protein Info for MMP_RS04470 in Methanococcus maripaludis S2

Annotation: nitrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00148: Oxidored_nitro" amino acids 15 to 428 (414 residues), 457.5 bits, see alignment E=1.8e-141

Best Hits

KEGG orthology group: K02592, nitrogenase molybdenum-iron protein NifN (inferred from 100% identity to mmp:MMP0859)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifN" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYX6 at UniProt or InterPro

Protein Sequence (458 amino acids)

>MMP_RS04470 nitrogenase (Methanococcus maripaludis S2)
MTEKKFAVINPCKICQPMGAIFALMGVKNSMPLIHGSHGCSTYMRFQLGRHFKEAVNVAS
SSMSEANAVLGGEENLKHAIRNVSKIYGPEIIGVTTSCLSETIGDDVEGIIRLFKTQNDD
LPEIVPISTPSYKHTHVEGYDSTVKALVENLATPSKPNSKLNVITGMVSPGDIAETKRIL
REMGIESIILTDTSESMDAPFDGEVSFVSSAGTTVEELKDTANSFATISLCKHANSAAKF
LHEAYGINSVSPYLPIGLQSTDEFMNELCKLTNKEIPEQITRERGKLIDAMIDAHQHNFG
RKVAIYGDPDVVVGFTRFVLELGMIPSIVCTGSESKTFVEDIKAVTKDSKHKPVILAPGD
LYDLHQEIKKSKVDLLIGNSYGSRIAGAENIPLIRMGFPIYDRVGAQRITSLGYTAGIRL
VDTITNTILDRYFDEFGWALNENTEVDHGEFESSNCIN