Protein Info for MMP_RS04455 in Methanococcus maripaludis S2

Annotation: nitrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR01284: nitrogenase alpha chain" amino acids 5 to 469 (465 residues), 709.4 bits, see alignment E=1.5e-217 TIGR01862: nitrogenase component I, alpha chain" amino acids 14 to 464 (451 residues), 658.3 bits, see alignment E=5e-202 PF00148: Oxidored_nitro" amino acids 49 to 457 (409 residues), 381.9 bits, see alignment E=1.7e-118

Best Hits

Swiss-Prot: 100% identical to NIFD_METMP: Nitrogenase molybdenum-iron protein alpha chain (nifD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02586, nitrogenase molybdenum-iron protein alpha chain [EC: 1.18.6.1] (inferred from 100% identity to mmp:MMP0856)

Predicted SEED Role

"Nitrogenase (molybdenum-iron) alpha chain (EC 1.18.6.1)" in subsystem Nitrogen fixation (EC 1.18.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW51 at UniProt or InterPro

Protein Sequence (477 amino acids)

>MMP_RS04455 nitrogenase subunit alpha (Methanococcus maripaludis S2)
MPFCLLDVDKDIPEREQHIYIKDSKEPKGHCKQRCNTNTIPGSMTERGCAFAGVKGVITG
AIKDVLHVVHSPVGCTAYGNGTTKRYPTRPEMPDGSVFPVENFNLKHIVGTDLTESDVVF
GGMNKLKKVIREASKEFPFVNAIYVYATCTTGLIGDDLDAVCKEMQAELGKDVVAFNAPG
FAGPTQSKGHHVGNYTIFEKLVGTKEPPKTTDYDINLIGEYNIDGDYWVLEKYFEDMGIN
VLSKFTGDATHGELCWMHKAKLSLVRCQRSATYVAKLIEEKYGVPYLKVDFFGPEYCAEN
LRAVGKYFGKEIEAEAVIKKEMEKIQPELDFYKSKLQGKKIWISAGGPKSWHLSKPIEQY
LGMDVVALSGLFEHEDGYEKMQERAKDGTIIIDDPNTLEMEEVVEKYQPEIVLGGIKEKY
FFHKLGVPSVMIHSYENGPYIGFEGFVNMARDIYTAIYNPAWKLMEFEEEEPGDSNE