Protein Info for MMP_RS04450 in Methanococcus maripaludis S2

Annotation: P-II family nitrogen regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00543: P-II
  • amino acids 1 to 117 (117 residues), 113.9 bits, E=2.4e-37

Best Hits

Swiss-Prot: 100% identical to GLNB2_METMP: Nitrogen fixation nifHD region glnB-like protein 2 (glnBII) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02590, nitrogen regulatory protein PII 2 (inferred from 100% identity to mmp:MMP0855)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

See P0CW47 at UniProt or InterPro

Protein Sequence (121 amino acids)

>MMP_RS04450 P-II family nitrogen regulator (Methanococcus maripaludis S2)
MKEIIAIIRPSKMAQTKTVLEGLGFPAMTANRVLGRGKQKAIVGELGFEVDNKELLNQPG
DMRYIPKTMLTLIVPDEDASLVVEAIMKVNKSGQYGDGKIFVCPIEDIITVRTSERGEAA
I