Protein Info for MMP_RS04430 in Methanococcus maripaludis S2

Annotation: DUF1847 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF08901: DUF1847" amino acids 27 to 177 (151 residues), 222.9 bits, see alignment E=7.9e-71

Best Hits

Swiss-Prot: 58% identical to Y455_METJA: Uncharacterized protein MJ0455 (MJ0455) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0851)

Predicted SEED Role

"M. jannaschii predicted coding region MJ0455"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYX8 at UniProt or InterPro

Protein Sequence (209 amino acids)

>MMP_RS04430 DUF1847 domain-containing protein (Methanococcus maripaludis S2)
MYYCALCNLKACKLGEPEKMPKKCPNSTKIIEKSKELYLEEENEKIAYNSALVESEGYCK
LTRIEETILFAKKMNYKKLGIAFCTGLSNEAKVLQDIFLNHDFDVESVVCKCGSIPKEFI
KITENEKVHKGEFEAMCNPIGQALFLNETKTDLNIILGLCVGHDSLFIKYSKAPVTIIGV
KDRVLGHNPLAAIYTSNSYYKEKLFKNKE