Protein Info for MMP_RS04365 in Methanococcus maripaludis S2

Annotation: M48 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF01863: YgjP-like" amino acids 13 to 220 (208 residues), 216.7 bits, see alignment E=3.7e-68 PF10263: SprT-like" amino acids 144 to 191 (48 residues), 32.3 bits, see alignment 7.9e-12

Best Hits

KEGG orthology group: K07043, (no description) (inferred from 100% identity to mmp:MMP0838)

Predicted SEED Role

"Putative predicted metal-dependent hydrolase" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYZ1 at UniProt or InterPro

Protein Sequence (222 amino acids)

>MMP_RS04365 M48 family metallopeptidase (Methanococcus maripaludis S2)
MVENVKIIRKKIKNMYLVVNPDCSVVVKAPVHVSDEYINSFIKKKESWIKKHLENFESLN
SKSVAKKYIDGELFKYLGNEYILKVYPSKKEYLEISDNFFNLYVLETNDFEKKKKIIEKF
YRKRAEIELFEIFKSNYKVVTEKMPDFSVRKMKKRWGSCSFHKNKIILNERLIEKSKDCI
EYVVFHELAHLRYPNHSKDFYNYLTELMPEWKVKKLKLNERH