Protein Info for MMP_RS04180 in Methanococcus maripaludis S2
Annotation: iron-containing alcohol dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 100% identity to mmp:MMP0802)Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- ethanol degradation II (2/3 steps found)
- pyruvate fermentation to ethanol III (2/3 steps found)
- ethanol degradation I (1/2 steps found)
- pyruvate fermentation to ethanol II (1/2 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- phytol degradation (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- L-methionine degradation III (1/3 steps found)
- pyruvate fermentation to ethanol I (1/3 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- (S)-propane-1,2-diol degradation (1/5 steps found)
- acetylene degradation (anaerobic) (1/5 steps found)
- ethanolamine utilization (1/5 steps found)
- phenylethanol biosynthesis (1/5 steps found)
- serotonin degradation (2/7 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
- butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (2/9 steps found)
- superpathway of N-acetylneuraminate degradation (10/22 steps found)
- heterolactic fermentation (7/18 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (3/13 steps found)
- noradrenaline and adrenaline degradation (2/13 steps found)
- mixed acid fermentation (4/16 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (3/17 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Metabolism of xenobiotics by cytochrome P450
- Retinol metabolism
- Tyrosine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZ27 at UniProt or InterPro
Protein Sequence (389 amino acids)
>MMP_RS04180 iron-containing alcohol dehydrogenase (Methanococcus maripaludis S2) MSFNMYVPTKVLFGAGQLNNLHEQKMPGKKAMIVISNGKSTREYGYLARTEEQLKLAGVE TVVFDKVEPNPLRSTVMAGGAFAKENDCDFIVALGGGSCIDASKAMSIMATNDGDYWDYI FGGTGKGMPLKAKPIPVVAITTTAGTGSETDPWAVVTHEINREKIGFGNEDTFPVLAVVD PELMKSVPPKYTAYQGFDALFHSVEGYVSIGANLMSDMYAITAIENVSKNLSKAVEDGND MDAREKVAFGNTLSGVVETVGLCTSQHALEHAMSAYHQDLPHGAGLIMISKAYFTHFIEK HVCDDRFVKMAKVMGMEDATEPMDFIRMLVKLQEECGVSDLKMSDYGITPEEFEKMAKNA VDTMGMLFTCDRAQLSIEDCVSIYSASYK