Protein Info for MMP_RS03830 in Methanococcus maripaludis S2

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF13742: tRNA_anti_2" amino acids 14 to 109 (96 residues), 106.5 bits, see alignment E=1.1e-34 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 15 to 403 (389 residues), 498 bits, see alignment E=1.1e-153 PF01336: tRNA_anti-codon" amino acids 37 to 110 (74 residues), 51.7 bits, see alignment E=1e-17 PF02601: Exonuc_VII_L" amino acids 132 to 348 (217 residues), 268.9 bits, see alignment E=1.1e-83 amino acids 301 to 401 (101 residues), 57.7 bits, see alignment E=2.1e-19

Best Hits

Swiss-Prot: 52% identical to EX7L_CLONN: Exodeoxyribonuclease 7 large subunit (xseA) from Clostridium novyi (strain NT)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to mmp:MMP0732)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ97 at UniProt or InterPro

Protein Sequence (407 amino acids)

>MMP_RS03830 exodeoxyribonuclease VII large subunit (Methanococcus maripaludis S2)
MLQLTLESSFSNTLTVSELNSYVKSTLEEDFLLKRACIKGEISNCTLHKSGHVYFTLKDE
NSAIDCVMFKPYTKKLDFSPAEGMSVIIKGKVSLYTKTGKYQFYCNEMEKEGLGDLFIKF
KKLKEKLESEGLFNEEYKQKIPKYPKNIGIITSPTGAAIRDIIKVTRNRNSSVNLIIYPA
VVQGESAAKTVISGISELNKLEKIDLIIIARGGGSMEDLWCFNNESLARAIFESKKPVIT
GIGHETDFTISDFVSDLRAATPSNAAEIAIYNEYELKSMINNLERMLKNRMKTEISNRSY
ELDILYSKIEKNSPKSKIEKQKVHVDKIRAQMNHEIKNKISYEVKRFEKSYSLLNAYNPL
NVLNKGYSIIQDENEKIISSKSSLNLENDVKITLKDGTVDAHITLKE