Protein Info for MMP_RS03805 in Methanococcus maripaludis S2

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR00631: excinuclease ABC subunit B" amino acids 6 to 642 (637 residues), 981.8 bits, see alignment E=7.2e-300 PF04851: ResIII" amino acids 12 to 95 (84 residues), 45.5 bits, see alignment E=2.7e-15 PF17757: UvrB_inter" amino acids 163 to 251 (89 residues), 106.9 bits, see alignment E=1.6e-34 PF27431: UvrB_3rd" amino acids 258 to 312 (55 residues), 68.2 bits, see alignment 1.7e-22 PF00271: Helicase_C" amino acids 433 to 542 (110 residues), 71.7 bits, see alignment E=2e-23 PF12344: UvrB" amino acids 549 to 591 (43 residues), 73.4 bits, see alignment 3.6e-24 PF02151: UVR" amino acids 610 to 644 (35 residues), 42.8 bits, see alignment (E = 1.1e-14)

Best Hits

Swiss-Prot: 100% identical to UVRB_METMP: UvrABC system protein B (uvrB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to mmp:MMP0727)

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZA2 at UniProt or InterPro

Protein Sequence (646 amino acids)

>MMP_RS03805 excinuclease ABC subunit UvrB (Methanococcus maripaludis S2)
MSSPDFKLKAEFKPKGSQLEAIAGLVKDLEKNPEKSKQTLLGVTGSGKTFTIANVIEKVQ
KPTLVIAHNKTLAAQLYNEFKEFFPENRVEYFVSYYDYYQPESYIPQKDQYIEKDAQINP
KIEQMRLRATSAILSRRDVIIVASVSCIYGLGNPELFKEMGFELKVGEKIKRSDIIEKLV
DIQYERNDMELVPGRFRVKGDTLDIIPGYQDDILRVEMFGDEIDRIYELDPKNMSKKHEI
DSFYMYPAKHFVIPEEDKKNAINSILKELDEWLPNLDMLKSHRLKQKTLYDIEMIEETGS
CKGIENYSRHFENRKEGEPAYCLLDYFPEDFLIVIDESHQTIPQIRGMYKGDRSRKQSLI
DYGFRLPSAYDNRPLKFEEFKKYMNNVIFVSATPGEYELDNSNQVVEQIIRPTGLLDPEV
EIRPIENQVEDIIKETEKMVEKGERVLITTLTKRLAEELTEYLAKRNVKARYLHSDIDTI
ERTEIIRNLRLGKFDCLVGINLLREGLDIPEVGFVGILDADKEGFLRNDKSLIQTIGRAA
RNANSKVVLYAGKMTDSIKKAVSETERRRKLQKEHNEKHNITPQTIVKPIREKVVDISDV
KHIPVADIPNVIVELEAEMYEAAEALEFEKAIKIRDTIAKLKKKIK