Protein Info for MMP_RS03740 in Methanococcus maripaludis S2

Annotation: indolepyruvate oxidoreductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01558: POR" amino acids 9 to 186 (178 residues), 147.2 bits, see alignment E=2.8e-47

Best Hits

KEGG orthology group: K00180, indolepyruvate ferredoxin oxidoreductase, beta subunit [EC: 1.2.7.8] (inferred from 100% identity to mmp:MMP0714)

Predicted SEED Role

"Indolepyruvate oxidoreductase subunit IorB (EC 1.2.7.8)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 1.2.7.8)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.8

Use Curated BLAST to search for 1.2.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZB5 at UniProt or InterPro

Protein Sequence (188 amino acids)

>MMP_RS03740 indolepyruvate oxidoreductase subunit beta (Methanococcus maripaludis S2)
MNIVIAAVGGQGAVLASKILGTLAQNLGKDVKVSEVHGMSQRGGSVVAYVKFGEKVYSPV
VEKGTADIVLAFEMLEGARYVDYLKENGKLVVNTQKIDPMPVITGDVKYPSDLNEKFEKL
NIGYVPVDALSIAKNAGTLKAVNVALIGVLAKNSNIKKEEWIKAIKDTVPEKFLELNLKA
FEMGYDLN