Protein Info for MMP_RS03700 in Methanococcus maripaludis S2

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 408 (396 residues), 179.8 bits, see alignment E=4e-57

Best Hits

Swiss-Prot: 58% identical to NAH2_METJA: Probable Na(+)/H(+) antiporter 2 (MJ1521) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0707)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZC2 at UniProt or InterPro

Protein Sequence (417 amino acids)

>MMP_RS03700 sodium:proton antiporter (Methanococcus maripaludis S2)
MEISLVIGYISLLFIIGSFIAKLADRIGIPDIPLLLITGLLIGPVLGLISPIYAQTIFSF
VGTIGLIILLLVGAFEMRWIVLKRVLKTVLKLDTIGLVISLLISGIIFSFIYALPFTNPI
GFIYGAVNCATDPATLIPIFSKSDVDPKIAVTLEAESVFNDPLGIVATTLTLSSLGLSKS
VNPILDFVMLAFGGLALGYVGGKIFEFVVSKDEFGEYIAPLGVGSAMALWFFGEDVAPHF
LGYGLSGYMAVAIMGLYIGNVVTKKPKNSKDMHKMAEFCTDLSSLTRILIFVFLGASISL
PLLKSFGIYGLLCAIGTLFIARPIGVFIATAIPPVSSLKERIYFALEGPRGVVPAALAAM
IYTNIMHNPGIIPHSITQYMPPEMIAGSILVATFATIFLSVIVEASWAYPLANKLFK