Protein Info for MMP_RS03695 in Methanococcus maripaludis S2
Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to WECC_METMP: UDP-N-acetyl-D-mannosamine dehydrogenase (wecC) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to mmp:MMP0706)Predicted SEED Role
"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)
MetaCyc Pathways
- UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- UDP-α-D-xylose biosynthesis (1/2 steps found)
- colanic acid building blocks biosynthesis (6/11 steps found)
- UDP-sugars interconversion (2/9 steps found)
- teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Starch and sucrose metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-
Use Curated BLAST to search for 1.1.1.- or 1.1.1.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZC3 at UniProt or InterPro
Protein Sequence (427 amino acids)
>MMP_RS03695 UDP-N-acetyl-D-mannosamine dehydrogenase (Methanococcus maripaludis S2) MEKHGDYDIKKICVIGLGYIGLPTASMLANHGYDVVGVDVNEKRVNQIKNGELKIEEPGL LTLVKGAINSKNLNVRTSATEADAFIICVPTPALAKEDGSKKCDLSYVMSAVEAILPFVK DGNLIVIESTIPPETTKKIYETLNKKIYVAHCPERVLPGKILKELVENDRIIGGINKKSA EMAKEIYKSFVEGQIYTTDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIK IANKHPRVNILNPGPGVGGHCISIDPWFIVEKTNNAKFIRAARELNDNMPAYVCNSVLSE LKKLGIEKPKISIFGATYKGNVEDTRESPSKNVIKMLLENGATVSTYDPHASYFEYPLST LDECISGSDCIVVLTDHDVFKTIKKDDIDEICPKLKNKIVFDTKNILEHSLWKKAGFTVK LLGNGAW