Protein Info for MMP_RS03685 in Methanococcus maripaludis S2

Annotation: Mrp/NBP35 family ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF10609: ParA" amino acids 38 to 282 (245 residues), 323.3 bits, see alignment E=3.5e-100 PF13614: AAA_31" amino acids 42 to 94 (53 residues), 36 bits, see alignment 2.4e-12 PF02374: ArsA_ATPase" amino acids 42 to 76 (35 residues), 21.6 bits, see alignment 3.9e-08 PF09140: MipZ" amino acids 43 to 161 (119 residues), 24.6 bits, see alignment E=5.4e-09 PF01656: CbiA" amino acids 43 to 210 (168 residues), 46.8 bits, see alignment E=1e-15 PF01583: APS_kinase" amino acids 45 to 89 (45 residues), 21.6 bits, see alignment 6.8e-08

Best Hits

Swiss-Prot: 100% identical to APBC_METMP: Iron-sulfur cluster carrier protein (MMP0704) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0704)

Predicted SEED Role

"Cytosolic Fe-S cluster assembling factor NBP35"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZC5 at UniProt or InterPro

Protein Sequence (289 amino acids)

>MMP_RS03685 Mrp/NBP35 family ATP-binding protein (Methanococcus maripaludis S2)
MAEECSGNCDSCGSSSDCSDTKKMMEQQNAQIRDNMSKIKYKIAVMSGKGGVGKSTVTVN
LAATLNMMGYKVGVLDGDIHGPNIPQMLGVDQIQPMADENGIYPVSTPQGIKTMSIGYFL
PDKNTPIIWRGPKASGAIRQFLSDVNWGELDFLLIDTPPGSGDIQITTLQAIPDIDGVVI
VTTPEEVSVLDARKSVSAANTLEIPIIGIVENMGGFVCPECDKVIDIFGKGGGEKAAKEL
NVFFLGRIPLDIKARVASDRGVPMVTMDCKASEEFKKVVNTVLERIKKE