Protein Info for MMP_RS03640 in Methanococcus maripaludis S2

Annotation: archaeal proteasome endopeptidase complex subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 13 to 195 (183 residues), 188.7 bits, E=4.3e-60
• TIGR03634: proteasome endopeptidase complex, archaeal, beta subunit
  • amino acids 14 to 200 (187 residues), 263.3 bits, E=5e-83

Best Hits

Swiss-Prot: 100% identical to PSB_METMP: Proteasome subunit beta (psmB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03433, proteasome beta subunit [EC: 3.4.25.1] (inferred from 100% identity to mmp:MMP0695)

Predicted SEED Role

"Proteasome subunit beta (EC 3.4.25.1), archaeal" in subsystem Proteasome archaeal (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

See Q6LZD4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>MMP_RS03640 archaeal proteasome endopeptidase complex subunit beta (Methanococcus maripaludis S2)
MISNSEYHKEYMKGTTTVGLLCNDGVVLATDKRATMGNLIADKEAKKLYKIDDYIAMTIA
GSVGDAQSLIRLISAEAKIYKMRTGNNMTPLSCTTLISNVLHGNRHYPLLTQLILGGYDL
INGAKLFSLDPVGGINEESSFTATGSGSPTAYGVLESEYKSDIAIEKGLLIAVKALSSAM
QRDAYSGNGISLAHINKDGVKLYSDAEIEGFLKKINRKR