Protein Info for MMP_RS03580 in Methanococcus maripaludis S2

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02881: SRP54_N" amino acids 79 to 143 (65 residues), 45.7 bits, see alignment E=6e-16 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 96 to 370 (275 residues), 339.2 bits, see alignment E=8.9e-106 PF00448: SRP54" amino acids 176 to 370 (195 residues), 247.3 bits, see alignment E=1e-77

Best Hits

Swiss-Prot: 63% identical to FTSY_METJA: Signal recognition particle receptor FtsY (ftsY) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to mmp:MMP0683)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZE6 at UniProt or InterPro

Protein Sequence (383 amino acids)

>MMP_RS03580 signal recognition particle-docking protein FtsY (Methanococcus maripaludis S2)
MFGSLKEKLNNTISKLSDKIYTKGEAKAVEESNLKETPEIIGEENKTNLKKPEKDLKEIN
TESFEKKEKIGFLDKLAVTKSIKKVLGKDVILTEDDIEDVLEEMEMELFEADVAFDVVEK
IIESLKNQLVGLKISAKDDPEEITINALKKSIKGILSQEKIDVFNLIDEKKANGEPAVLL
FVGINGTGKTTSISKLAYILKEKGYSAVMAAGDTFRAGAIEQLEEHGKNTGIKVIKHQKG
ADSAAVIYDAISHAKAKGLNVVLADTAGRQTTNINLMDEIKKVVRVTKPDLIIFVGDSLA
GNDAISQAEEFNNTININGAILTKTDADAKGGAALSIAYSIGKPILFMGVGQRYSDLQEF
DVDWMIKKLFSEESTKLSSERQF