Protein Info for MMP_RS03565 in Methanococcus maripaludis S2

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF14681: UPRTase" amino acids 15 to 216 (202 residues), 170.1 bits, see alignment E=4.7e-54 TIGR01091: uracil phosphoribosyltransferase" amino acids 16 to 217 (202 residues), 239.2 bits, see alignment E=1.8e-75 PF00156: Pribosyltran" amino acids 76 to 181 (106 residues), 38.7 bits, see alignment E=6.5e-14

Best Hits

Swiss-Prot: 100% identical to UPP_METMP: Uracil phosphoribosyltransferase (upp) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to mmp:MMP0680)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZE9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>MMP_RS03565 uracil phosphoribosyltransferase (Methanococcus maripaludis S2)
MIKDERWEGVYSFEDSPYLMETLTNLRNVSTENISFRKGLVRLGRYMGYELTKTMEFEEM
HVQTPLEKTKGIFPKDRSNVVIITILRAAFPLMEGLIKNFESAKVGIVSASRGHAPDFKI
EMNYIKVPQVTPEDTVIVSDPMIATGSTLIHVLKEFKDSKPKRMMIVGVLAAPEGINAVK
AEFPDVEIFVTKIDDKLNNDGYIVPGLGDAGDRAFGEPFKVSMLPQMHNLE