Protein Info for MMP_RS03560 in Methanococcus maripaludis S2

Annotation: Na+/H+ antiporter NhaC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 76 to 104 (29 residues), see Phobius details amino acids 124 to 135 (12 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 273 to 301 (29 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details amino acids 475 to 494 (20 residues), see Phobius details amino acids 499 to 522 (24 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 169 to 493 (325 residues), 208.3 bits, see alignment E=8.6e-66

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0679)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZF0 at UniProt or InterPro

Protein Sequence (525 amino acids)

>MMP_RS03560 Na+/H+ antiporter NhaC family protein (Methanococcus maripaludis S2)
MDFGILSLLPPVVAIGLALITKRVYMSLFLGILAGSLLYNNWNIVASASHIVNTIIGSVE
LTSITGISSFTGVGNLWNLLILLFLVMLGILIALITRAGGALAYGNWASTKIKSKEGASL
STSLLGILLFIDDYFNCLTVGTVMKPITDKFKISRAKLAYIIDSTAAPVCILMPVSSWFA
AVVGNLGESGVGTGALSSMSPSGVFFSAILYNTYALVALFMVSFIISFKKMDFGPMKVHE
KVATETGDLFNGDAETAAIESEIEPLSGGKISYLVLPLVVLILAIIFAFMISGGLFAGVG
IIESFLSMDASWGLFWGGLVTLLFTVIYFIVSKAVPAKDIANLFAKGSKLMLPAITILIL
AWSLGSVIGDLGTGTYLSSLIQNSLPVQILPAILFLLSGFMAFSTGTSWGTFGIMLPIAV
PMAVGLGMPEFVVPFVAAVLGGAIYGDHSSPISDTTIMSSTGAGTKHIDHVQTQLPYTTL
IGIMAFLGYLIVGYTINLGYWVSGLINLAFVAFAVYIGASFLSKK