Protein Info for MMP_RS03555 in Methanococcus maripaludis S2

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF13560: HTH_31" amino acids 125 to 178 (54 residues), 28.8 bits, see alignment 1.8e-10 PF12844: HTH_19" amino acids 125 to 178 (54 residues), 37.1 bits, see alignment 3.9e-13 PF01381: HTH_3" amino acids 128 to 179 (52 residues), 50.9 bits, see alignment 2e-17

Best Hits

Swiss-Prot: 100% identical to Y678_METMP: Putative HTH-type transcriptional regulatory protein MMP0678 (MMP0678) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07728, putative transcriptional regulator (inferred from 100% identity to mmp:MMP0678)

Predicted SEED Role

"Putative HTH-type transcriptional regulatory protein PF1851"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZF1 at UniProt or InterPro

Protein Sequence (326 amino acids)

>MMP_RS03555 transcriptional regulator (Methanococcus maripaludis S2)
MREVLLSECIDLLYESHFVISKPFGRSCFDLIAKKGNLRLLIKILKNIDSLSTEQSEELL
NISKMLQAVPVIIGTRTRNSVMEEGAVYERYGIKAVTFNTFREQLVGEPPVVYANRGGFF
VNIDGKVLRETREKLKISVGELAEVSRVSRKTIYKYEQNEANPSAEVAIKIEEYLDVPLI
KGINIMDCIDGLKSQKSRDDAFEKILKEGEDFKIRVIDILGDMGFNLLETTKAPFDAVAE
ESKGEDAENQNIIFTNIQETENEEIRRKAMIVDEISKILNSHSLLVLEKKTNENKRITSM
SISELEKIGDTVDLLDFIEKRKKSTK