Protein Info for MMP_RS03545 in Methanococcus maripaludis S2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF05673: DUF815" amino acids 198 to 462 (265 residues), 312.1 bits, see alignment E=4.6e-97 PF20720: nSTAND3" amino acids 247 to 309 (63 residues), 27.7 bits, see alignment E=4e-10 PF00004: AAA" amino acids 249 to 351 (103 residues), 32 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: K06923, (no description) (inferred from 100% identity to mmp:MMP0676)

Predicted SEED Role

"ATPase with chaperone activity, ATP-binding domain, diverged"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZF3 at UniProt or InterPro

Protein Sequence (465 amino acids)

>MMP_RS03545 ATP-binding protein (Methanococcus maripaludis S2)
MVNPQMSFLNNQNSMKFKFRKLLIDSNRIIIYRNLLDDKIIGYLINIIRELSEDKPDESI
VEKNYYGLTHDLIIKAENENLSGNILKSYIMNAILKDENIFAISCEKHYGNLESLYELAF
KDIGVLKRIMDIDTKHLRSIMDSEDETIENYTPTLYKDEKTVFSDYREELLNIDSVPELL
DSIIEYYYKIGSGELVDHVAFRWNNKTGFSGIKYCDLVDMENIVGYNYQKEILLKNTSAF
IEGNPANNILLVGSRGTGKSSLVKSLVKEYCLDGLRIIELKKSQLKDFGEMVDHLRNRNK
KFIVFLDDLSFEDNETEYKELKSVLEGTLEKKPENVIIYATSNRRNLIKESWSERDSDIH
SNDSINEKMSLSDRFGITLSFYSPTQEEYLNMVKKLAIENGINPCKADDVKFYSMNIGKL
SDQTGMIMAWETLREDAVKWGMSQNGFSGRTAKQFIDYIIGTYKN