Protein Info for MMP_RS03515 in Methanococcus maripaludis S2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 270 to 286 (17 residues), see Phobius details PF00892: EamA" amino acids 6 to 136 (131 residues), 83.9 bits, see alignment E=5.8e-28 amino acids 148 to 285 (138 residues), 66.6 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0670)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZF9 at UniProt or InterPro

Protein Sequence (296 amino acids)

>MMP_RS03515 DMT family transporter (Methanococcus maripaludis S2)
MNDRSLGILLMFLTVIFWGISFVSTKIILEFIPPITIGFIRVVIAAVILIFFIRNFTKYS
KEDFVYIVLAGFLGITSYYLFENVALKYTTATNASLIAATVPIFYLIVSDIVEKKIPSKI
KYFGSLIGLFGVFILILNGKFVLELNPLGDILMFGAVCTWVLYTFVIQKLQKHDDLKVTR
DITLIGAVFFIPFTIMELGYNGMFEFTILLNPYIAFSLLYLAIFCSAIAYLFWNMAIRLA
GASTTTNGVYIIPIVAMITDAIILKNIPNIYAIIGAVLVLFGVYISENGGKLKINL