Protein Info for MMP_RS03485 in Methanococcus maripaludis S2

Annotation: TIGR00267 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details TIGR00267: TIGR00267 family protein" amino acids 17 to 183 (167 residues), 203.9 bits, see alignment E=7e-65 PF01988: VIT1" amino acids 100 to 181 (82 residues), 50.8 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 53% identical to Y645_METJA: Uncharacterized protein MJ0645 (MJ0645) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0664)

Predicted SEED Role

"Uncharacterized protein MJ0645"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZG4 at UniProt or InterPro

Protein Sequence (186 amino acids)

>MMP_RS03485 TIGR00267 family protein (Methanococcus maripaludis S2)
VEIREVLRNFKQEFDTRYVVRGLIDGSLSTLGVVIGASGGETSIIIAAGIGGGIANGISN
ILGALTAERAIIEEEREKKEKSLLIGNGNLKGTHEYQYKLNKTMYSGTYDGLSTCVGAVI
PVIPFFIFDQSTALIMAIAFTLLILLGLGIFIGKLSRDNLLISGLKMVLGGVIVAVICFG
VESLFG