Protein Info for MMP_RS03465 in Methanococcus maripaludis S2

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 3 to 170 (168 residues), 217.6 bits, E=5.9e-69
• PF00156: Pribosyltran
  • amino acids 26 to 139 (114 residues), 50.9 bits, E=5.8e-18

Best Hits

Swiss-Prot: 100% identical to APT_METMP: Adenine phosphoribosyltransferase (apt2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 100% identity to mmp:MMP0660)

MetaCyc: 49% identical to adenine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of guanine and guanosine salvage (3/3 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• adenine and adenosine salvage I (1/2 steps found)
• adenine and adenosine salvage II (1/2 steps found)
• guanine and guanosine salvage II (1/2 steps found)
• adenine salvage (1/3 steps found)
• glyphosate degradation III (2/7 steps found)
• (aminomethyl)phosphonate degradation (2/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.7

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See Q6LZG8 at UniProt or InterPro

Protein Sequence (172 amino acids)

>MMP_RS03465 adenine phosphoribosyltransferase (Methanococcus maripaludis S2)
MDLRKKIRIVENFPIEGISFKDVTPILKDPKAMKHTTKEIAKYLEDKNVDVVVGPEARGF
LFGVPVAHELDIGFVPVRKPGKLPYKTFSVDYALEYGSDSLEIHSDGIEKGQNVAIVDDL
LATGGTVLGVSKLVEKLGGHVSALNFVIELTELKGRDKLKGYDIQSLVKYDL