Protein Info for MMP_RS03450 in Methanococcus maripaludis S2

Updated annotation (from data): glycine synthesis protein GlyXS
Rationale: Important in minimal medium except when glycine is added. A homolog from Bifidobacterium has similar phenotypes, so this appears to be part of a novel route for glycine synthesis, along with GlyXL (MMP_RS07345).
Original annotation: ACT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF13740: ACT_6" amino acids 3 to 79 (77 residues), 69.8 bits, see alignment E=1.4e-23 PF01842: ACT" amino acids 4 to 61 (58 residues), 38.4 bits, see alignment E=8.5e-14

Best Hits

Swiss-Prot: 100% identical to Y657_METMP: UPF0237 protein MMP0657 (MMP0657) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07166, ACT domain-containing protein (inferred from 100% identity to mmp:MMP0657)

Predicted SEED Role

"UPF0237 protein MJ1558"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZH1 at UniProt or InterPro

Protein Sequence (90 amino acids)

>MMP_RS03450 glycine synthesis protein GlyXS (Methanococcus maripaludis S2)
MENVVITVVGVDKPGIVAEVTKVLAQNSANIVDIRQTIMEDLFTMIMLVDISKISSDFSE
LNVALEKLGSEIGVKINVQHENIFKYMHRI