Protein Info for MMP_RS03435 in Methanococcus maripaludis S2

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07991: IlvN
  • amino acids 14 to 177 (164 residues), 252.4 bits, E=3.9e-79
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 14 to 328 (315 residues), 483.9 bits, E=8.6e-150
• PF03807: F420_oxidored
  • amino acids 18 to 92 (75 residues), 23.5 bits, E=1.8e-08
• PF03446: NAD_binding_2
  • amino acids 18 to 102 (85 residues), 28.1 bits, E=5e-10
• PF01450: IlvC
  • amino acids 183 to 324 (142 residues), 207.7 bits, E=2.3e-65

Best Hits

Swiss-Prot: 100% identical to ILVC_METMP: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 100% identity to mmp:MMP0654)

MetaCyc: 67% identical to acetohydroxy-acid isomeroreductase subunit (Methanothermobacter thermautotrophicus)
RXN-16061 [EC: 1.1.1.383]; 1.1.1.383 [EC: 1.1.1.383]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-isoleucine biosynthesis II (8/8 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• L-isoleucine biosynthesis IV (5/6 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (7/9 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (3/4 steps found)
• phosphopantothenate biosynthesis I (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of L-threonine metabolism (8/18 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (2/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.383 or 1.1.1.86

Sequence Analysis Tools

See Q6LZH4 at UniProt or InterPro

Protein Sequence (330 amino acids)

>MMP_RS03435 ketol-acid reductoisomerase (Methanococcus maripaludis S2)
MKVFYDSDFKLDALKEKTIAVIGYGSQGRAQSLNMKDSGLNVVVGLRKNGASWNNAKADG
HNVMTIEEAAEKADIIHILIPDELQAEVYESQIKPYLKEGKTLSFSHGFNIHYGFIVPPK
GVNVVLVAPKSPGKMVRRTYEEGFGVPGLICIEIDATNNAFDIVSAMAKGIGLSRAGVIQ
TTFKEETETDLFGEQAVLCGGVTELIKAGFETLVEAGYAPEMAYFETCHELKLIVDLIYQ
KGFKNMWNDVSNTAEYGGLTRRSRIVTADSKAAMKEILREIQDGRFTKEFLLEKQVSYAH
LKSMRRLEGDLQIEEVGAKLRKMCGLEKEE