Protein Info for MMP_RS03435 in Methanococcus maripaludis S2

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00465: ketol-acid reductoisomerase" amino acids 14 to 328 (315 residues), 483.9 bits, see alignment E=8.6e-150 PF07991: KARI_N" amino acids 14 to 177 (164 residues), 252.4 bits, see alignment E=3.9e-79 PF03446: NAD_binding_2" amino acids 18 to 102 (85 residues), 27.8 bits, see alignment E=6e-10 PF03807: F420_oxidored" amino acids 18 to 92 (75 residues), 23.7 bits, see alignment E=1.5e-08 PF01450: KARI_C" amino acids 183 to 324 (142 residues), 206.6 bits, see alignment E=5.1e-65

Best Hits

Swiss-Prot: 100% identical to ILVC_METMP: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 100% identity to mmp:MMP0654)

MetaCyc: 67% identical to acetohydroxy-acid isomeroreductase subunit (Methanothermobacter thermautotrophicus)
RXN-16061 [EC: 1.1.1.383]; 1.1.1.383 [EC: 1.1.1.383]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.383 or 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZH4 at UniProt or InterPro

Protein Sequence (330 amino acids)

>MMP_RS03435 ketol-acid reductoisomerase (Methanococcus maripaludis S2)
MKVFYDSDFKLDALKEKTIAVIGYGSQGRAQSLNMKDSGLNVVVGLRKNGASWNNAKADG
HNVMTIEEAAEKADIIHILIPDELQAEVYESQIKPYLKEGKTLSFSHGFNIHYGFIVPPK
GVNVVLVAPKSPGKMVRRTYEEGFGVPGLICIEIDATNNAFDIVSAMAKGIGLSRAGVIQ
TTFKEETETDLFGEQAVLCGGVTELIKAGFETLVEAGYAPEMAYFETCHELKLIVDLIYQ
KGFKNMWNDVSNTAEYGGLTRRSRIVTADSKAAMKEILREIQDGRFTKEFLLEKQVSYAH
LKSMRRLEGDLQIEEVGAKLRKMCGLEKEE