Protein Info for MMP_RS03420 in Methanococcus maripaludis S2
Annotation: acetolactate synthase small subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to ILVH_METJA: Probable acetolactate synthase small subunit (ilvH) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 99% identity to mmz:MmarC7_1675)MetaCyc: 76% identical to acetohydroxy-acid synthase small subunit (Methanococcus aeolicus)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]
Predicted SEED Role
"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (16/17 steps found)
- superpathway of L-isoleucine biosynthesis I (12/13 steps found)
- L-isoleucine biosynthesis II (8/8 steps found)
- L-valine biosynthesis (4/4 steps found)
- L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
- L-isoleucine biosynthesis IV (5/6 steps found)
- pyruvate fermentation to (R)-acetoin II (2/2 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- pyruvate fermentation to (R)-acetoin I (2/3 steps found)
- pyruvate fermentation to (S)-acetoin (2/3 steps found)
- superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
- L-isoleucine biosynthesis III (4/7 steps found)
- superpathway of 2,3-butanediol biosynthesis (2/6 steps found)
- superpathway of L-threonine metabolism (8/18 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Butanoate metabolism
- C5-Branched dibasic acid metabolism
- Pantothenate and CoA biosynthesis
- Valine, leucine and isoleucine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.2.1.6
Use Curated BLAST to search for 2.2.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZH7 at UniProt or InterPro
Protein Sequence (169 amino acids)
>MMP_RS03420 acetolactate synthase small subunit (Methanococcus maripaludis S2) MEHKHIISVLVLHKPGVLQRISGLFTRRWFNISSMTVGSTENPDVARMTIVVQGDDTVLE QVVKQLNKLVEVVKVTDLNSNKSVQRELCLVKVYAPTEDSKSQVIQYANIFRGKIIDLST ETLTVEITGDEQKVNAFLDLVRPMGIKEIARTGLTALMRGSKILKSNKA