Protein Info for MMP_RS03415 in Methanococcus maripaludis S2

Annotation: acetolactate synthase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 TIGR00118: acetolactate synthase, large subunit, biosynthetic type" amino acids 1 to 562 (562 residues), 847.5 bits, see alignment E=2.1e-259 PF02776: TPP_enzyme_N" amino acids 1 to 116 (116 residues), 140.8 bits, see alignment E=2.7e-45 PF00205: TPP_enzyme_M" amino acids 193 to 327 (135 residues), 178.6 bits, see alignment E=7.5e-57 PF02775: TPP_enzyme_C" amino acids 393 to 541 (149 residues), 185.2 bits, see alignment E=1e-58

Best Hits

Swiss-Prot: 72% identical to ILVB_METJA: Probable acetolactate synthase large subunit (ilvB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 100% identity to mmp:MMP0650)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZH8 at UniProt or InterPro

Protein Sequence (587 amino acids)

>MMP_RS03415 acetolactate synthase large subunit (Methanococcus maripaludis S2)
MKGAEAMMKALEAENVKVLFGYPGGQLLPFYDALYQSDLLHILTRHEQAAAHAADGYARA
SGDVGVCVATSGPGATNLVTGVATAHADSSPVVALTGQVPTKLIGNDAFQEIDALGIFMP
ITKHNFQIQKTSEIPKIFRKAFEIAKTGRPGAVHVDLPKDVQDDDLDLEKYPIPAEINLQ
GYKPTKFGHPLQIKKAAELMKIAQRPVIIAGGGVQIANATPELIKLSEYAQIPVCTTLMG
KGVFPEEHPLSLGMVGMHGTQASNYSVYESDVLIAIGCRFSDRITGDLSSFAPNTKVIHI
DIDPAEIGKNVGVDIPIVGDAKAILKDILIHLMKKEMVNKTEWMENVKKLQKKSMPVMEF
DNTPIKPQKVIKEMMAALREVDPGLTNTVLTTDVGQNQMWMAHYFQTSAPKSFLSSGGQG
TMGFGFPAAIGAKFARPDANVIAVTGDGGFLMNSQELATIAEYEIPVIVVIFDNRTLGMV
YQWQNLYYGKRQCAVHLGETPDFLKLAESYGIGALRVEKPEDINEAFKTALNSGKPYLLD
IIIDPSEALHMVPPGGNMTNILFPDRQEPTPKAQCFSEMKKILSPKV