Protein Info for MMP_RS03385 in Methanococcus maripaludis S2

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 289 (278 residues), 243.6 bits, see alignment E=1.3e-76 PF01545: Cation_efflux" amino acids 16 to 207 (192 residues), 167 bits, see alignment E=7e-53 PF16916: ZT_dimer" amino acids 212 to 289 (78 residues), 82.1 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0644)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZI4 at UniProt or InterPro

Protein Sequence (291 amino acids)

>MMP_RS03385 cation diffusion facilitator family transporter (Methanococcus maripaludis S2)
VEVSERIIIGNKISKITIIANIALSILKILAGVFGKSSALIADGMHSFSDILSTVVVMLG
LKLSEKPADESHPYGHERIEPALTKILAVILLVTALMIFYCGLTTIIGGNYQIPGNITII
AALISIFTKEWMYKYTKKGAEQIESSALLADAWHHRSDAFSSVGTLIGVVGAKLGYPILD
PIASIVISLFIAKMAFEIYFKALNQLLDRAADSKTIEEIKKIILSVDGVLEIDVLKTRIH
SNKIYVDVEISVDKDLSLIEAHNISENVHSQIESKLKRVKHCMVHVNPYLK