Protein Info for MMP_RS03335 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 312 to 340 (29 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 235 (215 residues), 128.5 bits, see alignment E=4.4e-41 PF02687: FtsX" amino acids 272 to 390 (119 residues), 70.4 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mmp:MMP0634)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZJ3 at UniProt or InterPro

Protein Sequence (397 amino acids)

>MMP_RS03335 ABC transporter permease (Methanococcus maripaludis S2)
MKPKDVVSFAGRNITQKKTQSLLTIIGIVIGILAIVSLISLGYGVQNYITEEISKAGASV
ITVYPSQQITSIAMSKNFNDRDLKAVEDVRGVDVVLYGWFGGTQVTYHDQEYYSSVFATK
SSTYQIFFTEAYGYELEKGRWMKDSDKYTCVIGYSLAHDTFDREIDIGDKIEINDKKYKV
VGILEQIGNPDDDNSIVIPYEAASEVFDVDDEYNMFMVKIKDGEDVTKVSEDIEDELEDS
RGDENFSVLTAEQLAESISSIFSVLTIFLVGVAGISLLVGAVGISNTMHMSILERRKDIG
ILKALGAENNTILSIFVVEAGFLGLFGGIVGTILGILIAKAIEYVAAISGYGLIRAWISW
ELIVGVLVFSFVVGILSGYFPARSGAKLNPVDTLRGE