Protein Info for MMP_RS03320 in Methanococcus maripaludis S2

Annotation: metal-dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF01325: Fe_dep_repress" amino acids 1 to 60 (60 residues), 59.8 bits, see alignment E=3.7e-20 PF01047: MarR" amino acids 19 to 54 (36 residues), 27.6 bits, see alignment E=3.3e-10 PF02742: Fe_dep_repr_C" amino acids 66 to 131 (66 residues), 96 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 58% identical to Y568_METJA: Uncharacterized HTH-type transcriptional regulator MJ0568 (MJ0568) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03709, DtxR family transcriptional regulator, Mn-dependent transcriptional regulator (inferred from 100% identity to mmp:MMP0631)

Predicted SEED Role

"Iron-dependent repressor IdeR/DtxR" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZJ6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>MMP_RS03320 metal-dependent transcriptional regulator (Methanococcus maripaludis S2)
MVSQNIEDYLENIFLFIKENKRPVKTTELAKLMKVQPAAVTSMAKKLHGDGLIDYQPYIG
INLKSSGEKIAKETIRKHRIIEYFLTEILGLDLEFAQEEACKIEHAVSDKTIEKLYEFID
RPEKCPHGYKINLK