Protein Info for MMP_RS03315 in Methanococcus maripaludis S2

Annotation: ferrous iron transport protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 PF04023: FeoA" amino acids 10 to 68 (59 residues), 52.8 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K04758, ferrous iron transport protein A (inferred from 91% identity to mmz:MmarC7_1654)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (68 amino acids)

>MMP_RS03315 ferrous iron transport protein A (Methanococcus maripaludis S2)
MENLLLKDPGSYMVVKVEGHCRKFYELGILPGCKITLISRNNRGPVLIRVGNSKVALGRG
MAESIFVE