Protein Info for MMP_RS03310 in Methanococcus maripaludis S2

Annotation: ferrous iron transport protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 279 to 301 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 338 to 362 (25 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 417 to 442 (26 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details amino acids 506 to 525 (20 residues), see Phobius details amino acids 555 to 578 (24 residues), see Phobius details amino acids 590 to 612 (23 residues), see Phobius details amino acids 624 to 644 (21 residues), see Phobius details PF02421: FeoB_N" amino acids 7 to 160 (154 residues), 206.2 bits, see alignment E=5e-65 PF01926: MMR_HSR1" amino acids 7 to 98 (92 residues), 65.7 bits, see alignment E=1e-21 TIGR00437: ferrous iron transport protein B" amino acids 11 to 611 (601 residues), 547.7 bits, see alignment E=1.9e-168 PF17910: FeoB_Cyto" amino acids 173 to 267 (95 residues), 64.1 bits, see alignment E=3.1e-21 PF07670: Gate" amino acids 347 to 439 (93 residues), 66.6 bits, see alignment E=6.3e-22 amino acids 507 to 614 (108 residues), 53 bits, see alignment E=1e-17 PF07664: FeoB_C" amino acids 452 to 502 (51 residues), 52.7 bits, see alignment 7.3e-18

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 100% identity to mmp:MMP0630)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZJ7 at UniProt or InterPro

Protein Sequence (647 amino acids)

>MMP_RS03310 ferrous iron transport protein B (Methanococcus maripaludis S2)
MDEKNIIALLGQPNVGKTTLFNHLTGMKQRIGNWPGVTVEKKEGFFKKNSESYVVVDLPG
IYSLMSDSIDQKIARDYLIENNEVTVIDVIDTPNINRNLYLTIQLLELGISPILCLNLID
EAEKFGIYINDQKLSEKLGVSVIRTSGRHKIGIDNLKDTIYKYKAGKPVKITYSPLLEEN
IGKIINKLENTQYNISENYERLPKRWIAISLLEKDPDVVNEFSKYPEFIKFVKDLKNEIE
NEIKHDVESYVVEQRYKKCDEILAGVMVNSELYEDIDTIVIHPIYGLMIFGVVLYTMYNF
VFGVGDIFAGVIGTFFEILGNYLMNILPQSLSGVIVDGLLAGVGGVLEFFPIVFLIMFSL
SILEDTGYLSRVTALTHSIMSKMGLSGKSFIPLITGFGCSVPALMGTRFISSHKERLITL
LVTPLVPCSARFVIIGFFASFFFVEHAALFTLSILAITFALLFMVSYVLSKFMKGEAEEY
IFELPPYRIPDWDNIIKMTWEKSKEFLKKAGTVIAAGSILFYGLVNYPSPDANYAAVVGK
ILEHVTLYMGLDWRAAISLVFGIFAKELVVSSFSILYPENISTAFSPLKAFVLTLVSVLY
IPCLATLATLYLETRSLKWTAFGIGYNLALATVVGIITYNLGTLLGF