Protein Info for MMP_RS03245 in Methanococcus maripaludis S2

Annotation: DNA repair and recombination protein RadB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR02237: DNA repair and recombination protein RadB" amino acids 2 to 209 (208 residues), 235 bits, see alignment E=4e-74 PF08423: Rad51" amino acids 2 to 207 (206 residues), 69 bits, see alignment E=5.9e-23 PF06745: ATPase" amino acids 2 to 213 (212 residues), 43.8 bits, see alignment E=3.2e-15 PF00154: RecA" amino acids 8 to 207 (200 residues), 50.2 bits, see alignment E=3.8e-17

Best Hits

Swiss-Prot: 100% identical to RADB_METMI: DNA repair and recombination protein RadB (radB) from Methanococcus maripaludis

KEGG orthology group: K04484, DNA repair protein RadB (inferred from 100% identity to mmp:MMP0617)

Predicted SEED Role

"DNA repair and recombination protein RadB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW61 at UniProt or InterPro

Protein Sequence (216 amino acids)

>MMP_RS03245 DNA repair and recombination protein RadB (Methanococcus maripaludis S2)
MLEELLNGNIEKKTITQIYGPPGVGKTNICIISMLKAIENGKNVVYIDTEGSLSIERIKQ
LSGKDCDELLKNIIIYEPSSFEEQSEALEKIFLLENVGLIIIDGIVSLYRLELCDKINEN
TKLNRMLGKQISNLLKVSRQKNSGILITNQVKDSINGIEPAGGRLLEYWSKSIIKIEKSE
SIRKLTLEKHRHAKEGENLRFKILQNGLEIINKSYQ