Protein Info for MMP_RS03175 in Methanococcus maripaludis S2

Annotation: translation initiation factor eIF-1A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 TIGR00523: translation initiation factor eIF-1A" amino acids 9 to 101 (93 residues), 149.5 bits, see alignment E=1.1e-48 PF01176: eIF-1a" amino acids 22 to 85 (64 residues), 74.4 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 100% identical to IF1A_METMP: Translation initiation factor 1A (eif1a) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03236, translation initiation factor 1A (inferred from 98% identity to mmx:MmarC6_0289)

Predicted SEED Role

"Translation initiation factor 1A" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZM1 at UniProt or InterPro

Protein Sequence (104 amino acids)

>MMP_RS03175 translation initiation factor eIF-1A (Methanococcus maripaludis S2)
MRGQQTPPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIW
VREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNRKGYLDFMR