Protein Info for MMP_RS03110 in Methanococcus maripaludis S2

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 4 to 123 (120 residues), 92.1 bits, E=2e-30

Best Hits

Swiss-Prot: 61% identical to Y544_METJA: Uncharacterized protein MJ0544 (MJ0544) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0590)

Predicted SEED Role

"Glycosyl transferase, family 2 (EC 2.4.1.83)" (EC 2.4.1.83)

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (2/19 steps found)

KEGG Metabolic Maps

• N-Glycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

See Q6LZN4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>MMP_RS03110 glycosyltransferase family 2 protein (Methanococcus maripaludis S2)
MVAVIPAYNEEKNIISVLKDLSDINIDVIVVDDGSTDKTKTIINEFLEKNEFKNKIFPIF
KEKNEGKSKALEDGTNYAINLNYDAIAYLDGDYQHKPSDIIPMYEKMKSENADAVFGIRK
YKHIPFHRQFSNFLASVIMSITVSVFSGNFHIFRDIQCGFRIIKSEFLKNSYFGDGYSVE
HLIALQLAKKNAKITEEYVTIDYHNDAISYITTKKILDVVKEVAKYVLSKH