Protein Info for MMP_RS03090 in Methanococcus maripaludis S2

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 214 to 245 (32 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 8 to 380 (373 residues), 240.9 bits, see alignment E=1.1e-75

Best Hits

Swiss-Prot: 57% identical to NAH3_METJA: Probable Na(+)/H(+) antiporter 3 (MJ1275) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0587)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZN7 at UniProt or InterPro

Protein Sequence (389 amino acids)

>MMP_RS03090 cation:proton antiporter (Methanococcus maripaludis S2)
MDTYFLFFIILTSIFIVPQILKRFNVPTITATMLAGILIGPFGLNIIQSSATLDTFAAFG
VIFLMFLAGLEVDNETLKDEFKNSLVLSLFSMLIPSIGGYLIGQYFGLDFIGSLLYAVIF
SSHSVGIVYALMDELGLIKSRFGTTVISASVVIDLISLIVISILIKMGGSGITSDIIPFV
VLIAAYIIALLIIIPLISKLILKELKKFHVQKIHFILLIILISIIVGEHIGIHPIIGAFI
IGIAVSEELTKEEHDQILNENLNAIGYGIFIPLFFLNLGMTTDISVIFNFDNISLILVSV
VTLIGLKISSGYFSLRILDYGKLKSFCGGLLTVPSLTASLVGATLGRDLGILPEKFFVSV
VVIALLTSTVAPIYVKSLVSKNYDKLKLN