Protein Info for MMP_RS03020 in Methanococcus maripaludis S2

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00254: FKBP_C" amino acids 2 to 93 (92 residues), 38.9 bits, see alignment E=1.4e-13 PF22199: FKBP26_IF" amino acids 88 to 133 (46 residues), 77.9 bits, see alignment 6.7e-26 PF18046: FKBP26_C" amino acids 157 to 220 (64 residues), 67.7 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 56% identical to FKBP2_METJA: Putative FKBP-type peptidyl-prolyl cis-trans isomerase MJ0825 (MJ0825) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 100% identity to mmp:MMP0572)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase MJ0825 (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZQ2 at UniProt or InterPro

Protein Sequence (228 amino acids)

>MMP_RS03020 peptidylprolyl isomerase (Methanococcus maripaludis S2)
MEKGKLVKISYEGYVDENLFDTTNEELAKEKGIFNPNMVYGPVTISAGEKMLIPGLDGAI
MEMNVGEERELDLTAENAFGKRDPSQVKIVPMKEFKKHKVNPIPGMPVNIDNKIGKVVSA
NGGRILVDFNHELAGKDLKYKLKIEEVVEAPEAIALEVAKLFIPRISEEDLKITIDGENV
TLDLPENTAFMQNLQMVKMGISNELIKRLEAKKVSFIDNFVKKEEKTE