Protein Info for MMP_RS02925 in Methanococcus maripaludis S2

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 2 to 138 (137 residues), 165.2 bits, E=1.1e-52
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 2 to 302 (301 residues), 426 bits, E=3.9e-132
• PF00185: OTCace
  • amino acids 144 to 300 (157 residues), 194.8 bits, E=1e-61

Best Hits

Swiss-Prot: 100% identical to OTC_METMP: Ornithine carbamoyltransferase (argF) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to mmp:MMP0553)

MetaCyc: 48% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline degradation (3/3 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• urea cycle (3/5 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See Q6LZS1 at UniProt or InterPro

Protein Sequence (304 amino acids)

>MMP_RS02925 ornithine carbamoyltransferase (Methanococcus maripaludis S2)
MDLLTLWNLEREEVLKIIEDAEYFKKNRYGHEILKNKSIALIFESPSTRTRMSFDLAVNE
LGGHSLMMNEGEIHLGKKESIADTARVMSRFVDAIVARVKNHKTLEDLAEYGSVPVINAL
CDLAHPCQILADLLTMKENGKNFKGLKLAYFGDGNNVSNSLMIAGAILGMDVVIATPRSY
EPNGLFVKKALEIIAKYGEGSLTLTDDPEIAAKDADVLYTDVWISMSDKNKQMDEILKIF
PKFQINDEILSKAKKDAIVLHCLPANRGLEITDEVIDGKQSKVFDQAENRLHAQKAVLKY
IFEH