Protein Info for MMP_RS02885 in Methanococcus maripaludis S2

Annotation: molybdopterin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 PF03453: MoeA_N" amino acids 8 to 171 (164 residues), 155 bits, see alignment E=2.7e-49 TIGR00177: molybdenum cofactor synthesis domain" amino acids 181 to 315 (135 residues), 102.7 bits, see alignment E=8.8e-34 PF00994: MoCF_biosynth" amino acids 185 to 315 (131 residues), 103.2 bits, see alignment E=2.1e-33 PF03454: MoeA_C" amino acids 324 to 390 (67 residues), 48.6 bits, see alignment E=1.6e-16 PF12727: PBP_like" amino acids 418 to 597 (180 residues), 199.1 bits, see alignment E=8.3e-63

Best Hits

Swiss-Prot: 61% identical to Y886_METJA: Putative molybdopterin biosynthesis protein MJ0886 (MJ0886) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA K07219, putative molybdopterin biosynthesis protein (inferred from 100% identity to mmp:MMP0545)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA / Periplasmic molybdate-binding domain" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZS8 at UniProt or InterPro

Protein Sequence (616 amino acids)

>MMP_RS02885 molybdopterin biosynthesis protein (Methanococcus maripaludis S2)
LRYLELCTIDHAKEVVRTLLNELSTEEVSLFELPGKMLAEDIVSSVDVPPFDRSRMDGYA
VRAKDTYEAEEDKPVTLEIIDKIRAGGNSDLEILPGQCMEIATGAPLPKGADAVVMVEFA
EIEGNSVKLYKAVSPHENIQPCGNDIMVGELIMRKNTVISPRDIGAISAVGKNKLKVFKN
PSIGLLSTGNELISPDDKLEPYKIYDVNTYTIASSILEKGWNFNFYGIVQDNKEDLMEKL
KKAMNEDVILLSGGTSAGVGDLTSTAIEELGGEILVHGIKIKPGKPTIIGRIGKKLVVGL
PGYPTSCLTIFDVLFNEKGKTMRAQVYNRYMSAKGREEYLPVSIIRGNDGYGAYPVLKGS
EAITSLTYADGYIIIPENKEIVEDEIFDVHMFGDIRIGLNIIGSHCVGIDRILRKGHILA
RTVNTGSLGGIMAVKRKEADIAGIHLLDNNGEYNVSYLKKYNVSDAVLVRGYIREQGFMF
KKELGIKSIDDLIEKIRDYRIINRNKGSGTRILFDKFLKENNVDKNSIDGYDIEAKTHSA
VGTAVSMGKAQIGLGISTISDHYGLEFIPIADEYYDLLIPKEKLYDEDIIKFIETLKKEE
LPFKKSKDTGKIIYEC