Protein Info for MMP_RS02840 in Methanococcus maripaludis S2

Annotation: DUF123 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00730: HhH-GPD" amino acids 43 to 177 (135 residues), 92.2 bits, see alignment E=3.9e-30 PF00633: HHH" amino acids 109 to 135 (27 residues), 32.7 bits, see alignment (E = 6.6e-12) PF01986: DUF123" amino acids 265 to 353 (89 residues), 93.7 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 60% identical to END3_METJA: Endonuclease III (nth) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 100% identity to mmp:MMP0537)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZT6 at UniProt or InterPro

Protein Sequence (356 amino acids)

>MMP_RS02840 DUF123 domain-containing protein (Methanococcus maripaludis S2)
MNDFDTTFIKFLDILDEKLKKDAVVDKISKNSDKNERAFKILISTVISARTKDETTAKVS
KELFKKVKNPKDLVQIPIDELEKLVHPAGFYKTKAKNLKKLGEILIDKYNSNVPNSIEEL
VTLPGVGRKTANLVMTLAFDDYAICVDTHVHRITNRWYYADTESPENTEMDLRKKLPKNY
WKKINNLLVVFGQETCSPIPKCDKCFSEIKKICPHYNSLKEIEKIYADFNFKKTPKTKIP
KDKGTYVLKIKMNSPKTILVGKREIKFKKGDYFYIGSAMGDSMNLYNRISRHLSDSKKKR
WHIDYLLEFSNVKEVNVTLGRFECDVSQRFNLVLDSIESFGCSDCKCKSHLYYIKP