Protein Info for MMP_RS02795 in Methanococcus maripaludis S2

Annotation: sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 71 to 102 (32 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 320 to 350 (31 residues), see Phobius details amino acids 371 to 401 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 8 to 529 (522 residues), 403.9 bits, see alignment E=5.4e-125 PF00916: Sulfate_transp" amino acids 12 to 374 (363 residues), 299.5 bits, see alignment E=3.3e-93 PF01740: STAS" amino acids 434 to 530 (97 residues), 58.1 bits, see alignment E=6.8e-20

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to mmp:MMP0529)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZU4 at UniProt or InterPro

Protein Sequence (552 amino acids)

>MMP_RS02795 sulfate permease (Methanococcus maripaludis S2)
MKINNNLNYENLKNDLFAGFTIAIVALPLAMAFAIASGVSPEKGLFTAIIAGFLISVFGG
SKYQIGGPTGAFVVILYGIIASYGYEGLVIATLMAGVILIIMGLLKLGNIIKFIPYPVTM
GFTSGIALIIFSTQVKDFFGLSITNVPATFLGQWITYATNIQLLNPYALLISILSLVILT
KSKKVFSKIPSPIIAIIVGIVLVYAFNLPVETIESKFGQIPNSIPFPSLPELNFQKMELL
FPSALSIAFLGAIESLMCAVVADGMTGYKHNSNKELIGQGIANIGSVLFGGIPATGALAR
TATNIKAGATSRLSGIIHSVMLFLFMLLLSPLILKIPLATLSAILVVVAWNMAEVKHFKS
ILFKSPKRDRIVLLVTFLLTIFVNLNTAIQIGMLLAVIVFMQRLIEVSEISNLKTVPQEE
DPDSITLKDVPPCIEVYEINGPFFFGIADKFKSTLNVVAKRKPSAIILRMRNVPIIDSTG
IKNLEEFIESSKIQNISLIISGADYKLRAKFEKYGLTDKIGNENICENIDLALVRAREII
KIKHPETGLCPK